SMU1 anticorps

N° du produit ABIN632943

Cet anticorps anti-SMU1 est un anticorps Lapin Polyclonal détectant SMU1 dans WB. Adapté pour Humain.

Aperçu rapide pour SMU1 anticorps (ABIN632943)

Antigène: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMU1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMU1 anticorps

Purification: Affinity purified

Immunogène: SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMU1 Blocking Peptide, (ABIN940001), is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMU1

Antigène: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Autre désignation: SMU1

Sujet: SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.

Poids moléculaire: 57 kDa (MW of target protein)